SCOPe 2.04: Domain d3ozya2: 3ozy A:133-387

Lineage for d3ozya2 (3ozy A:133-387)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (59 species)
   not a true protein

7. Species Bordetella bronchiseptica [TaxId:518] [256003] (3 PDB entries)

8. Domain d3ozya2: 3ozy A:133-387 [248395]
   Other proteins in same PDB: d3ozya1, d3ozyb1
   automated match to d3sjna2
   complexed with acy, dxl, gol, mg

Details for d3ozya2

PDB Entry: 3ozy, 1.3 Å

PDB Description: Crystal structure of enolase superfamily member from Bordetella bronchiseptica complexed with Mg and m-Xylarate

PDB Compounds: (A:) Putative mandelate racemase

SCOPe Domain Sequences for d3ozya2:

Sequence; same for both SEQRES and ATOM records:

>d3ozya2 c.1.11.0 (A:133-387) automated matches {Bordetella bronchiseptica [TaxId: 518]}
kfhtrgvrayassiywdltpdqaadelagwveqgftaaklkvgraprkdaanlramrqrv
gadveilvdanqslgrhdalamlrildeagcywfeeplsiddieghrilraqgtpvriat
genlytrnafndyirndaidvlqadasraggitealaisasaasahlawnphtfndiitv
aanlhlvaasphpamfewdithndlmtrlasydlklenglvqppqgpglgfeidwdfvaa
hawkgepaigaghgm

Timeline for d3ozya2:

• d3ozya2 is new in SCOPe 2.04-stable
  
• d3ozya2 appears in SCOPe 2.05
  
• d3ozya2 appears in the current release, SCOPe 2.08