SCOPe 2.08: Domain d3ozwb3: 3ozw B:262-403

Lineage for d3ozwb3 (3ozw B:262-403)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.0: automated matches [227163] (1 protein)
   not a true family

6. Protein automated matches [226871] (19 species)
   not a true protein

7. Species Ralstonia eutropha [TaxId:381666] [256011] (3 PDB entries)

8. Domain d3ozwb3: 3ozw B:262-403 [248393]
   Other proteins in same PDB: d3ozwa1, d3ozwa2, d3ozwb1, d3ozwb2
   automated match to d1cqxa3
   complexed with dgg, fad, hem, kkk, po4

Details for d3ozwb3

PDB Entry: 3ozw, 2.3 Å

PDB Description: The Crystal Structure of flavohemoglobin from R. eutrophus in complex with ketoconazole

PDB Compounds: (B:) Flavohemoglobin

SCOPe Domain Sequences for d3ozwb3:

Sequence; same for both SEQRES and ATOM records:

>d3ozwb3 c.25.1.0 (B:262-403) automated matches {Ralstonia eutropha [TaxId: 381666]}
dvdaktpivlisggvgltpmvsmlkvalqapprqvvfvhgarnsavhamrdrlreaakty
enldlfvfydqplpedvqgrdydypglvdvkqieksillpdadyyicgpipfmrmqhdal
knlgihearihyevfgpdlfae

Timeline for d3ozwb3:

• d3ozwb3 first appeared in SCOPe 2.04
  
• d3ozwb3 appears in SCOPe 2.07