| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) ![]() binds NADP differently than classical Rossmann-fold N-terminal FAD-linked domain contains (6,10) barrel |
| Family c.25.1.0: automated matches [227163] (1 protein) not a true family |
| Protein automated matches [226871] (19 species) not a true protein |
| Species Ralstonia eutropha [TaxId:381666] [256011] (3 PDB entries) |
| Domain d3ozwb3: 3ozw B:262-403 [248393] Other proteins in same PDB: d3ozwa1, d3ozwa2, d3ozwb1, d3ozwb2 automated match to d1cqxa3 complexed with dgg, fad, hem, kkk, po4 |
PDB Entry: 3ozw (more details), 2.3 Å
SCOPe Domain Sequences for d3ozwb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ozwb3 c.25.1.0 (B:262-403) automated matches {Ralstonia eutropha [TaxId: 381666]}
dvdaktpivlisggvgltpmvsmlkvalqapprqvvfvhgarnsavhamrdrlreaakty
enldlfvfydqplpedvqgrdydypglvdvkqieksillpdadyyicgpipfmrmqhdal
knlgihearihyevfgpdlfae
Timeline for d3ozwb3: