Lineage for d3ozwb3 (3ozw B:262-403)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2859730Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2859731Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2859901Family c.25.1.0: automated matches [227163] (1 protein)
    not a true family
  6. 2859902Protein automated matches [226871] (19 species)
    not a true protein
  7. 2860007Species Ralstonia eutropha [TaxId:381666] [256011] (3 PDB entries)
  8. 2860010Domain d3ozwb3: 3ozw B:262-403 [248393]
    Other proteins in same PDB: d3ozwa1, d3ozwa2, d3ozwb1, d3ozwb2
    automated match to d1cqxa3
    complexed with dgg, fad, hem, kkk, po4

Details for d3ozwb3

PDB Entry: 3ozw (more details), 2.3 Å

PDB Description: The Crystal Structure of flavohemoglobin from R. eutrophus in complex with ketoconazole
PDB Compounds: (B:) Flavohemoglobin

SCOPe Domain Sequences for d3ozwb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ozwb3 c.25.1.0 (B:262-403) automated matches {Ralstonia eutropha [TaxId: 381666]}
dvdaktpivlisggvgltpmvsmlkvalqapprqvvfvhgarnsavhamrdrlreaakty
enldlfvfydqplpedvqgrdydypglvdvkqieksillpdadyyicgpipfmrmqhdal
knlgihearihyevfgpdlfae

SCOPe Domain Coordinates for d3ozwb3:

Click to download the PDB-style file with coordinates for d3ozwb3.
(The format of our PDB-style files is described here.)

Timeline for d3ozwb3: