| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.0: automated matches [191420] (1 protein) not a true family |
| Protein automated matches [190590] (26 species) not a true protein |
| Species Ralstonia eutropha [TaxId:381666] [256009] (3 PDB entries) |
| Domain d3ozwb1: 3ozw B:1-150 [248391] Other proteins in same PDB: d3ozwa2, d3ozwa3, d3ozwb2, d3ozwb3 automated match to d1cqxa1 complexed with dgg, fad, hem, kkk, po4 |
PDB Entry: 3ozw (more details), 2.3 Å
SCOPe Domain Sequences for d3ozwb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ozwb1 a.1.1.0 (B:1-150) automated matches {Ralstonia eutropha [TaxId: 381666]}
mltqktkdivkatapvlaehgydiikcfyqrmfeahpelknvfnmahqeqgqqqqalara
vyayaeniedpnslmavlkniankhaslgvkpeqypivgehllaaikevlgnaatddiis
awaqaygnladvlmgmeselyersaeqpgg
Timeline for d3ozwb1: