Lineage for d3ozwb1 (3ozw B:1-150)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1718504Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 1718505Protein automated matches [190590] (18 species)
    not a true protein
  7. 1718613Species Ralstonia eutropha [TaxId:381666] [256009] (3 PDB entries)
  8. 1718616Domain d3ozwb1: 3ozw B:1-150 [248391]
    Other proteins in same PDB: d3ozwa2, d3ozwa3, d3ozwb2, d3ozwb3
    automated match to d1cqxa1
    complexed with dgg, fad, hem, kkk, po4

Details for d3ozwb1

PDB Entry: 3ozw (more details), 2.3 Å

PDB Description: The Crystal Structure of flavohemoglobin from R. eutrophus in complex with ketoconazole
PDB Compounds: (B:) Flavohemoglobin

SCOPe Domain Sequences for d3ozwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ozwb1 a.1.1.0 (B:1-150) automated matches {Ralstonia eutropha [TaxId: 381666]}
mltqktkdivkatapvlaehgydiikcfyqrmfeahpelknvfnmahqeqgqqqqalara
vyayaeniedpnslmavlkniankhaslgvkpeqypivgehllaaikevlgnaatddiis
awaqaygnladvlmgmeselyersaeqpgg

SCOPe Domain Coordinates for d3ozwb1:

Click to download the PDB-style file with coordinates for d3ozwb1.
(The format of our PDB-style files is described here.)

Timeline for d3ozwb1: