SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3ozwb1 (3ozw B:1-150)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1979217Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 1979218Protein automated matches [190590] (19 species)
    not a true protein
  7. 1979326Species Ralstonia eutropha [TaxId:381666] [256009] (3 PDB entries)
  8. 1979329Domain d3ozwb1: 3ozw B:1-150 [248391]
    Other proteins in same PDB: d3ozwa2, d3ozwa3, d3ozwb2, d3ozwb3
    automated match to d1cqxa1
    complexed with dgg, fad, hem, kkk, po4

Details for d3ozwb1

PDB Entry: 3ozw (more details), 2.3 Å

PDB Description: The Crystal Structure of flavohemoglobin from R. eutrophus in complex with ketoconazole
PDB Compounds: (B:) Flavohemoglobin

SCOPe Domain Sequences for d3ozwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ozwb1 a.1.1.0 (B:1-150) automated matches {Ralstonia eutropha [TaxId: 381666]}
mltqktkdivkatapvlaehgydiikcfyqrmfeahpelknvfnmahqeqgqqqqalara
vyayaeniedpnslmavlkniankhaslgvkpeqypivgehllaaikevlgnaatddiis
awaqaygnladvlmgmeselyersaeqpgg

SCOPe Domain Coordinates for d3ozwb1:

Click to download the PDB-style file with coordinates for d3ozwb1.
(The format of our PDB-style files is described here.)

Timeline for d3ozwb1: