Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) binds NADP differently than classical Rossmann-fold N-terminal FAD-linked domain contains (6,10) barrel |
Family c.25.1.0: automated matches [227163] (1 protein) not a true family |
Protein automated matches [226871] (18 species) not a true protein |
Species Ralstonia eutropha [TaxId:381666] [256011] (3 PDB entries) |
Domain d3ozua3: 3ozu A:262-403 [248381] Other proteins in same PDB: d3ozua1, d3ozua2 automated match to d1cqxa3 complexed with fad, hem, po4, x89 |
PDB Entry: 3ozu (more details), 2 Å
SCOPe Domain Sequences for d3ozua3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ozua3 c.25.1.0 (A:262-403) automated matches {Ralstonia eutropha [TaxId: 381666]} dvdaktpivlisggvgltpmvsmlkvalqapprqvvfvhgarnsavhamrdrlreaakty enldlfvfydqplpedvqgrdydypglvdvkqieksillpdadyyicgpipfmrmqhdal knlgihearihyevfgpdlfae
Timeline for d3ozua3: