Class a: All alpha proteins [46456] (285 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.0: automated matches [191420] (1 protein) not a true family |
Protein automated matches [190590] (15 species) not a true protein |
Species Ralstonia eutropha [TaxId:381666] [256009] (3 PDB entries) |
Domain d3ozua1: 3ozu A:1-150 [248379] Other proteins in same PDB: d3ozua2, d3ozua3 automated match to d1cqxa1 complexed with fad, hem, po4, x89 |
PDB Entry: 3ozu (more details), 2 Å
SCOPe Domain Sequences for d3ozua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ozua1 a.1.1.0 (A:1-150) automated matches {Ralstonia eutropha [TaxId: 381666]} mltqktkdivkatapvlaehgydiikcfyqrmfeahpelknvfnmahqeqgqqqqalara vyayaeniedpnslmavlkniankhaslgvkpeqypivgehllaaikevlgnaatddiis awaqaygnladvlmgmeselyersaeqpgg
Timeline for d3ozua1: