Lineage for d3ozua1 (3ozu A:1-150)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2689395Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 2689396Protein automated matches [190590] (26 species)
    not a true protein
  7. 2689529Species Ralstonia eutropha [TaxId:381666] [256009] (3 PDB entries)
  8. 2689530Domain d3ozua1: 3ozu A:1-150 [248379]
    Other proteins in same PDB: d3ozua2, d3ozua3
    automated match to d1cqxa1
    complexed with fad, hem, po4, x89

Details for d3ozua1

PDB Entry: 3ozu (more details), 2 Å

PDB Description: The Crystal Structure of flavohemoglobin from R. eutrophus in complex with miconazole
PDB Compounds: (A:) flavohemoprotein

SCOPe Domain Sequences for d3ozua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ozua1 a.1.1.0 (A:1-150) automated matches {Ralstonia eutropha [TaxId: 381666]}
mltqktkdivkatapvlaehgydiikcfyqrmfeahpelknvfnmahqeqgqqqqalara
vyayaeniedpnslmavlkniankhaslgvkpeqypivgehllaaikevlgnaatddiis
awaqaygnladvlmgmeselyersaeqpgg

SCOPe Domain Coordinates for d3ozua1:

Click to download the PDB-style file with coordinates for d3ozua1.
(The format of our PDB-style files is described here.)

Timeline for d3ozua1: