SCOPe 2.08: Domain d3ozmh1: 3ozm H:4-132

Lineage for d3ozmh1 (3ozm H:4-132)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Bordetella bronchiseptica [TaxId:518] [256002] (4 PDB entries)

8. Domain d3ozmh1: 3ozm H:4-132 [248377]
   Other proteins in same PDB: d3ozma2, d3ozma3, d3ozmb2, d3ozmb3, d3ozmc2, d3ozmc3, d3ozmd2, d3ozmd3, d3ozme2, d3ozme3, d3ozmf2, d3ozmf3, d3ozmg2, d3ozmg3, d3ozmh2, d3ozmh3
   automated match to d3sjna1
   complexed with dxl, gol, ly9, mg

Details for d3ozmh1

PDB Entry: 3ozm, 1.6 Å

PDB Description: Crystal structure of enolase superfamily member from Bordetella bronchiseptica complexed with Mg, m-Xylarate and L-Lyxarate

PDB Compounds: (H:) Putative mandelate racemase

SCOPe Domain Sequences for d3ozmh1:

Sequence; same for both SEQRES and ATOM records:

>d3ozmh1 d.54.1.0 (H:4-132) automated matches {Bordetella bronchiseptica [TaxId: 518]}
kitevkahalstpipermrvesgaglklnrqmilvevrtdegvtgvgspsgpydlavlkr
aiedvigpqligedpaninylwhkvfhgevsrnlghrsvgiaamsgvdialwdlkgramn
qpiyqllgg

Timeline for d3ozmh1:

• d3ozmh1 first appeared in SCOPe 2.04
  
• d3ozmh1 appears in SCOPe 2.07