Lineage for d3nuc__ (3nuc -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 13575Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) (S)
  5. 13576Family b.40.1.1: Staphylococcal nuclease [50200] (1 protein)
  6. 13577Protein Staphylococcal nuclease [50201] (1 species)
  7. 13578Species Staphylococcus aureus [TaxId:1280] [50202] (52 PDB entries)
  8. 13605Domain d3nuc__: 3nuc - [24836]

Details for d3nuc__

PDB Entry: 3nuc (more details), 1.9 Å

PDB Description: staphlococcal nuclease, 1-n-propane thiol disulfide to v23c variant

SCOP Domain Sequences for d3nuc__:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nuc__ b.40.1.1 (-) Staphylococcal nuclease {Staphylococcus aureus}
lhkepatlikaidgdtcklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkmv
enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqhlr
kseaqakkeklniws

SCOP Domain Coordinates for d3nuc__:

Click to download the PDB-style file with coordinates for d3nuc__.
(The format of our PDB-style files is described here.)

Timeline for d3nuc__: