Class g: Small proteins [56992] (94 folds) |
Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) metal(zinc)-bound alpha+beta fold |
Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) |
Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins) |
Protein 2MIHB/C-IAP-1 [57926] (1 species) baculoviral inhibitor of apoptosis |
Species Human (Homo sapiens) [TaxId:9606] [57927] (6 PDB entries) |
Domain d3oz1d_: 3oz1 D: [248359] automated match to d2uvlb_ complexed with bmb, zn |
PDB Entry: 3oz1 (more details), 3 Å
SCOPe Domain Sequences for d3oz1d_:
Sequence, based on SEQRES records: (download)
>d3oz1d_ g.52.1.1 (D:) 2MIHB/C-IAP-1 {Human (Homo sapiens) [TaxId: 9606]} rfsisnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwe sgddpwvehakwfprceflirmkgqefvdeiqgryphlleqll
>d3oz1d_ g.52.1.1 (D:) 2MIHB/C-IAP-1 {Human (Homo sapiens) [TaxId: 9606]} rfsisnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgnddvkcfccdgglrcwes gddpwvehakwfprceflirmkgqefvdeiqgryphlleqll
Timeline for d3oz1d_: