Lineage for d3oz1d_ (3oz1 D:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038051Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 3038052Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 3038053Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 3038054Protein 2MIHB/C-IAP-1 [57926] (1 species)
    baculoviral inhibitor of apoptosis
  7. 3038055Species Human (Homo sapiens) [TaxId:9606] [57927] (6 PDB entries)
  8. 3038067Domain d3oz1d_: 3oz1 D: [248359]
    Other proteins in same PDB: d3oz1b2
    automated match to d2uvlb_
    complexed with bmb, zn

Details for d3oz1d_

PDB Entry: 3oz1 (more details), 3 Å

PDB Description: cIAP1-BIR3 domain in complex with the Smac-mimetic compound Smac066
PDB Compounds: (D:) Baculoviral IAP repeat-containing protein 2

SCOPe Domain Sequences for d3oz1d_:

Sequence, based on SEQRES records: (download)

>d3oz1d_ g.52.1.1 (D:) 2MIHB/C-IAP-1 {Human (Homo sapiens) [TaxId: 9606]}
rfsisnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwe
sgddpwvehakwfprceflirmkgqefvdeiqgryphlleqll

Sequence, based on observed residues (ATOM records): (download)

>d3oz1d_ g.52.1.1 (D:) 2MIHB/C-IAP-1 {Human (Homo sapiens) [TaxId: 9606]}
rfsisnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgnddvkcfccdgglrcwes
gddpwvehakwfprceflirmkgqefvdeiqgryphlleqll

SCOPe Domain Coordinates for d3oz1d_:

Click to download the PDB-style file with coordinates for d3oz1d_.
(The format of our PDB-style files is described here.)

Timeline for d3oz1d_: