SCOPe 2.08: Domain d3oz1b1: 3oz1 B:253-355

Lineage for d3oz1b1 (3oz1 B:253-355)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families)

5. Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)

6. Protein 2MIHB/C-IAP-1 [57926] (1 species)
   baculoviral inhibitor of apoptosis

7. Species Human (Homo sapiens) [TaxId:9606] [57927] (6 PDB entries)

8. Domain d3oz1b1: 3oz1 B:253-355 [248357]
   Other proteins in same PDB: d3oz1b2
   automated match to d2uvlb_
   complexed with bmb, zn

Details for d3oz1b1

PDB Entry: 3oz1, 3 Å

PDB Description: cIAP1-BIR3 domain in complex with the Smac-mimetic compound Smac066

PDB Compounds: (B:) Baculoviral IAP repeat-containing protein 2

SCOPe Domain Sequences for d3oz1b1:

Sequence; same for both SEQRES and ATOM records:

>d3oz1b1 g.52.1.1 (B:253-355) 2MIHB/C-IAP-1 {Human (Homo sapiens) [TaxId: 9606]}
fsisnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwes
gddpwvehakwfprceflirmkgqefvdeiqgryphlleqlls

Timeline for d3oz1b1:

• d3oz1b1 first appeared in SCOPe 2.04, called d3oz1b_
  
• d3oz1b1 appears in SCOPe 2.07