Lineage for d3oz1a_ (3oz1 A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2642738Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 2642739Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 2642740Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 2642741Protein 2MIHB/C-IAP-1 [57926] (1 species)
    baculoviral inhibitor of apoptosis
  7. 2642742Species Human (Homo sapiens) [TaxId:9606] [57927] (6 PDB entries)
  8. 2642751Domain d3oz1a_: 3oz1 A: [248356]
    Other proteins in same PDB: d3oz1b2
    automated match to d2uvlb_
    complexed with bmb, zn

Details for d3oz1a_

PDB Entry: 3oz1 (more details), 3 Å

PDB Description: cIAP1-BIR3 domain in complex with the Smac-mimetic compound Smac066
PDB Compounds: (A:) Baculoviral IAP repeat-containing protein 2

SCOPe Domain Sequences for d3oz1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oz1a_ g.52.1.1 (A:) 2MIHB/C-IAP-1 {Human (Homo sapiens) [TaxId: 9606]}
fsisnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwes
gddpwvehakwfprceflirmkgqefvdeiqgryphlleqlls

SCOPe Domain Coordinates for d3oz1a_:

Click to download the PDB-style file with coordinates for d3oz1a_.
(The format of our PDB-style files is described here.)

Timeline for d3oz1a_: