Lineage for d3oz1a_ (3oz1 A:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1707316Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 1707317Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 1707318Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 1707319Protein 2MIHB/C-IAP-1 [57926] (1 species)
    baculoviral inhibitor of apoptosis
  7. 1707320Species Human (Homo sapiens) [TaxId:9606] [57927] (6 PDB entries)
  8. 1707329Domain d3oz1a_: 3oz1 A: [248356]
    automated match to d2uvlb_
    complexed with bmb, zn

Details for d3oz1a_

PDB Entry: 3oz1 (more details), 3 Å

PDB Description: cIAP1-BIR3 domain in complex with the Smac-mimetic compound Smac066
PDB Compounds: (A:) Baculoviral IAP repeat-containing protein 2

SCOPe Domain Sequences for d3oz1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oz1a_ g.52.1.1 (A:) 2MIHB/C-IAP-1 {Human (Homo sapiens) [TaxId: 9606]}
fsisnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwes
gddpwvehakwfprceflirmkgqefvdeiqgryphlleqlls

SCOPe Domain Coordinates for d3oz1a_:

Click to download the PDB-style file with coordinates for d3oz1a_.
(The format of our PDB-style files is described here.)

Timeline for d3oz1a_: