![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) ![]() |
![]() | Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
![]() | Protein automated matches [226904] (32 species) not a true protein |
![]() | Species Campylobacter jejuni [TaxId:192222] [256007] (2 PDB entries) |
![]() | Domain d3ouzb2: 3ouz B:117-329 [248350] Other proteins in same PDB: d3ouza1, d3ouza3, d3ouza4, d3ouzb1, d3ouzb3 automated match to d1ulza3 complexed with adp, fmt, gol, mg, mlt, srt, tla |
PDB Entry: 3ouz (more details), 1.9 Å
SCOPe Domain Sequences for d3ouzb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ouzb2 d.142.1.0 (B:117-329) automated matches {Campylobacter jejuni [TaxId: 192222]} kskakqvmqragvpvipgsdgalagaeaakklakeigypvilkaaaggggrgmrvvenek dlekaywsaeseamtafgdgtmymekyiqnprhievqvigdsfgnvihvgerdcsmqrrh qklieespailldektrtrlhetaikaakaigyegagtfeflvdknldfyfiemntrlqv ehcvsemvsgidiieqmikvaegyalpsqesik
Timeline for d3ouzb2:
![]() Domains from other chains: (mouse over for more information) d3ouza1, d3ouza2, d3ouza3, d3ouza4 |