Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (9 families) precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.0: automated matches [227183] (1 protein) not a true family |
Protein automated matches [226903] (25 species) not a true protein |
Species Campylobacter jejuni [TaxId:192222] [256006] (2 PDB entries) |
Domain d3ouua1: 3ouu A:-2-116 [248340] Other proteins in same PDB: d3ouua2, d3ouua3, d3ouub2, d3ouub3 automated match to d1ulza2 complexed with anp, ca, cac, fmt, gol |
PDB Entry: 3ouu (more details), 2.25 Å
SCOPe Domain Sequences for d3ouua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ouua1 c.30.1.0 (A:-2-116) automated matches {Campylobacter jejuni [TaxId: 192222]} snameiksilianrgeialralrtikemgkkaicvyseadkdalylkyadasicigkars sesylnipaiiaaaeiaeadaifpgygflsenqnfveicakhnikfigpsveamnlmsd
Timeline for d3ouua1: