SCOPe 2.04: Domain d3ouua1: 3ouu A:-2-116

Lineage for d3ouua1 (3ouu A:-2-116)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (9 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.0: automated matches [227183] (1 protein)
   not a true family

6. Protein automated matches [226903] (25 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:192222] [256006] (2 PDB entries)

8. Domain d3ouua1: 3ouu A:-2-116 [248340]
   Other proteins in same PDB: d3ouua2, d3ouua3, d3ouub2, d3ouub3
   automated match to d1ulza2
   complexed with anp, ca, cac, fmt, gol

Details for d3ouua1

PDB Entry: 3ouu, 2.25 Å

PDB Description: Crystal Structure of Biotin Carboxylase-beta-gamma-ATP Complex from Campylobacter jejuni

PDB Compounds: (A:) biotin carboxylase

SCOPe Domain Sequences for d3ouua1:

Sequence; same for both SEQRES and ATOM records:

>d3ouua1 c.30.1.0 (A:-2-116) automated matches {Campylobacter jejuni [TaxId: 192222]}
snameiksilianrgeialralrtikemgkkaicvyseadkdalylkyadasicigkars
sesylnipaiiaaaeiaeadaifpgygflsenqnfveicakhnikfigpsveamnlmsd

Timeline for d3ouua1:

• d3ouua1 is new in SCOPe 2.04-stable
  
• d3ouua1 appears in SCOPe 2.05
  
• d3ouua1 appears in the current release, SCOPe 2.08