| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold |
Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) ![]() duplication: contains multiple CxxCH motifs |
| Family a.138.1.0: automated matches [227152] (1 protein) not a true family |
| Protein automated matches [226857] (5 species) not a true protein |
| Species Geobacter sulfurreducens [TaxId:35554] [256005] (2 PDB entries) |
| Domain d3ouqa2: 3ouq A:82-161 [248339] automated match to d1rwja_ complexed with hem |
PDB Entry: 3ouq (more details), 2.6 Å
SCOPe Domain Sequences for d3ouqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ouqa2 a.138.1.0 (A:82-161) automated matches {Geobacter sulfurreducens [TaxId: 35554]}
gsarpvayrmkgageavfshevhvpmlegkcrtchsnreitggrnvtmaqmekgkscgac
hndkmaftvagncgkchkgm
Timeline for d3ouqa2: