Lineage for d3ouqa2 (3ouq A:82-161)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2347197Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 2347198Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2347523Family a.138.1.0: automated matches [227152] (1 protein)
    not a true family
  6. 2347524Protein automated matches [226857] (5 species)
    not a true protein
  7. 2347533Species Geobacter sulfurreducens [TaxId:35554] [256005] (2 PDB entries)
  8. 2347536Domain d3ouqa2: 3ouq A:82-161 [248339]
    automated match to d1rwja_
    complexed with hem

Details for d3ouqa2

PDB Entry: 3ouq (more details), 2.6 Å

PDB Description: structure of n-terminal hexaheme fragment of gsu1996
PDB Compounds: (A:) Cytochrome c family protein

SCOPe Domain Sequences for d3ouqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ouqa2 a.138.1.0 (A:82-161) automated matches {Geobacter sulfurreducens [TaxId: 35554]}
gsarpvayrmkgageavfshevhvpmlegkcrtchsnreitggrnvtmaqmekgkscgac
hndkmaftvagncgkchkgm

SCOPe Domain Coordinates for d3ouqa2:

Click to download the PDB-style file with coordinates for d3ouqa2.
(The format of our PDB-style files is described here.)

Timeline for d3ouqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ouqa1