SCOPe 2.08: Domain d3ouqa2: 3ouq A:82-161

Lineage for d3ouqa2 (3ouq A:82-161)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.0: automated matches [227152] (1 protein)
   not a true family

6. Protein automated matches [226857] (5 species)
   not a true protein

7. Species Geobacter sulfurreducens [TaxId:35554] [256005] (2 PDB entries)

8. Domain d3ouqa2: 3ouq A:82-161 [248339]
   automated match to d1rwja_
   complexed with hec

Details for d3ouqa2

PDB Entry: 3ouq, 2.6 Å

PDB Description: structure of n-terminal hexaheme fragment of gsu1996

PDB Compounds: (A:) Cytochrome c family protein

SCOPe Domain Sequences for d3ouqa2:

Sequence; same for both SEQRES and ATOM records:

>d3ouqa2 a.138.1.0 (A:82-161) automated matches {Geobacter sulfurreducens [TaxId: 35554]}
gsarpvayrmkgageavfshevhvpmlegkcrtchsnreitggrnvtmaqmekgkscgac
hndkmaftvagncgkchkgm

Timeline for d3ouqa2:

• d3ouqa2 first appeared in SCOPe 2.04
  
• d3ouqa2 appears in SCOPe 2.07