Lineage for d3ouna_ (3oun A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778062Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 2778063Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 2778206Family b.26.1.0: automated matches [191616] (1 protein)
    not a true family
  6. 2778207Protein automated matches [191125] (8 species)
    not a true protein
  7. 2778238Species Mycobacterium tuberculosis [TaxId:1773] [189619] (3 PDB entries)
  8. 2778241Domain d3ouna_: 3oun A: [248337]
    automated match to d3po8a_
    complexed with mn

Details for d3ouna_

PDB Entry: 3oun (more details), 2.71 Å

PDB Description: crystal structure of the fhaa fha domain complexed with the intracellular domain of rv3910
PDB Compounds: (A:) Putative uncharacterized protein TB39.8

SCOPe Domain Sequences for d3ouna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ouna_ b.26.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
svtlqlddgsgrtyqlregsniigrgqdaqfrlpdtgvsrrhleirwdgqvalladlnst
ngttvnnapvqewqladgdvirlghseiivr

SCOPe Domain Coordinates for d3ouna_:

Click to download the PDB-style file with coordinates for d3ouna_.
(The format of our PDB-style files is described here.)

Timeline for d3ouna_: