![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold |
![]() | Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) ![]() duplication: contains multiple CxxCH motifs |
![]() | Family a.138.1.0: automated matches [227152] (1 protein) not a true family |
![]() | Protein automated matches [226857] (4 species) not a true protein |
![]() | Species Geobacter sulfurreducens [TaxId:35554] [256005] (2 PDB entries) |
![]() | Domain d3ouea2: 3oue A:240-318 [248334] Other proteins in same PDB: d3ouea1 automated match to d1rwja_ complexed with hem, so4 |
PDB Entry: 3oue (more details), 2.15 Å
SCOPe Domain Sequences for d3ouea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ouea2 a.138.1.0 (A:240-318) automated matches {Geobacter sulfurreducens [TaxId: 35554]} glkpakltyktsvgeayfdhdihlsmfkcadchtkvfkyrkgsapatmadmekgkscgvc hngkdafsvaddcvkchnm
Timeline for d3ouea2: