SCOPe 2.08: Domain d3ouea2: 3oue A:240-318

Lineage for d3ouea2 (3oue A:240-318)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.0: automated matches [227152] (1 protein)
   not a true family

6. Protein automated matches [226857] (5 species)
   not a true protein

7. Species Geobacter sulfurreducens [TaxId:35554] [256005] (2 PDB entries)

8. Domain d3ouea2: 3oue A:240-318 [248334]
   Other proteins in same PDB: d3ouea1
   automated match to d1rwja_
   complexed with hec, so4

Details for d3ouea2

PDB Entry: 3oue, 2.15 Å

PDB Description: structure of c-terminal hexaheme fragment of gsu1996

PDB Compounds: (A:) Cytochrome c family protein

SCOPe Domain Sequences for d3ouea2:

Sequence; same for both SEQRES and ATOM records:

>d3ouea2 a.138.1.0 (A:240-318) automated matches {Geobacter sulfurreducens [TaxId: 35554]}
glkpakltyktsvgeayfdhdihlsmfkcadchtkvfkyrkgsapatmadmekgkscgvc
hngkdafsvaddcvkchnm

Timeline for d3ouea2:

• d3ouea2 first appeared in SCOPe 2.04
  
• d3ouea2 appears in SCOPe 2.07