![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.138: Multiheme cytochromes [48694] (1 superfamily) variable number of helices and little beta structure; not a true fold |
![]() | Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) ![]() duplication: contains multiple CxxCH motifs |
![]() | Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins) |
![]() | Protein automated matches [190934] (3 species) not a true protein |
![]() | Species Geobacter sulfurreducens [TaxId:35554] [189147] (16 PDB entries) |
![]() | Domain d3ouea1: 3oue A:161-239 [248333] Other proteins in same PDB: d3ouea2 automated match to d1rwja_ complexed with hem, so4 |
PDB Entry: 3oue (more details), 2.15 Å
SCOPe Domain Sequences for d3ouea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ouea1 a.138.1.1 (A:161-239) automated matches {Geobacter sulfurreducens [TaxId: 35554]} mtppktvnfkmkgvadaafshefhlgmykcnechtklfaykagakrftmadmdkgkscga chngkdafssasdcgkchp
Timeline for d3ouea1: