Lineage for d3ouea1 (3oue A:161-239)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734165Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2734166Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2734167Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins)
  6. 2734256Protein automated matches [190934] (3 species)
    not a true protein
  7. 2734262Species Geobacter sulfurreducens [TaxId:35554] [189147] (10 PDB entries)
  8. 2734270Domain d3ouea1: 3oue A:161-239 [248333]
    Other proteins in same PDB: d3ouea2
    automated match to d1rwja_
    complexed with hec, so4

Details for d3ouea1

PDB Entry: 3oue (more details), 2.15 Å

PDB Description: structure of c-terminal hexaheme fragment of gsu1996
PDB Compounds: (A:) Cytochrome c family protein

SCOPe Domain Sequences for d3ouea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ouea1 a.138.1.1 (A:161-239) automated matches {Geobacter sulfurreducens [TaxId: 35554]}
mtppktvnfkmkgvadaafshefhlgmykcnechtklfaykagakrftmadmdkgkscga
chngkdafssasdcgkchp

SCOPe Domain Coordinates for d3ouea1:

Click to download the PDB-style file with coordinates for d3ouea1.
(The format of our PDB-style files is described here.)

Timeline for d3ouea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ouea2