Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) |
Family c.33.1.0: automated matches [191389] (1 protein) not a true family |
Protein automated matches [190499] (20 species) not a true protein |
Species Bordetella bronchiseptica [TaxId:518] [256004] (2 PDB entries) |
Domain d3ot4h_: 3ot4 H: [248330] automated match to d3hb7a_ |
PDB Entry: 3ot4 (more details), 2.4 Å
SCOPe Domain Sequences for d3ot4h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ot4h_ c.33.1.0 (H:) automated matches {Bordetella bronchiseptica [TaxId: 518]} syerqgfgaalplkapygllivdfvngfadpaqfgggniaaaiettrtvlaaarergwav ahsrivyadddadgnifsikvpgmltlkehapasaivpqlapqageyvvrkstpsafygt mlaawlaqrgvqtllvagattsgcvrasvvdamsagfrplvlsdcvgdralgpheanlfd mrqkyaavmthdealakt
Timeline for d3ot4h_:
View in 3D Domains from other chains: (mouse over for more information) d3ot4c_, d3ot4d_, d3ot4f_, d3ot4g_ |