| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
| Protein automated matches [226923] (79 species) not a true protein |
| Species Bordetella bronchiseptica [TaxId:518] [256003] (4 PDB entries) |
| Domain d3op2b2: 3op2 B:133-380 [248321] Other proteins in same PDB: d3op2a1, d3op2a3, d3op2b1, d3op2b3 automated match to d3sjna2 complexed with akg, mg, po4 |
PDB Entry: 3op2 (more details), 2 Å
SCOPe Domain Sequences for d3op2b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3op2b2 c.1.11.0 (B:133-380) automated matches {Bordetella bronchiseptica [TaxId: 518]}
kfhtrgvrayassiywdltpdqaadelagwveqgftaaklkvgraprkdaanlramrqrv
gadveilvdanqslgrhdalamlrildeagcywfeeplsiddieghrilraqgtpvriat
genlytrnafndyirndaidvlqadasraggitealaisasaasahlawnphtfndiitv
aanlhlvaasphpamfewdithndlmtrlasydlklenglvqppqgpglgfeidwdfvaa
hawkgepa
Timeline for d3op2b2: