Lineage for d3op2a1 (3op2 A:4-132)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2947989Species Bordetella bronchiseptica [TaxId:518] [256002] (4 PDB entries)
  8. 2948002Domain d3op2a1: 3op2 A:4-132 [248318]
    Other proteins in same PDB: d3op2a2, d3op2a3, d3op2b2, d3op2b3
    automated match to d3sjna1
    complexed with akg, mg, po4

Details for d3op2a1

PDB Entry: 3op2 (more details), 2 Å

PDB Description: crystal structure of putative mandelate racemase from bordetella bronchiseptica rb50 complexed with 2-oxoglutarate/phosphate
PDB Compounds: (A:) Putative mandelate racemase

SCOPe Domain Sequences for d3op2a1:

Sequence, based on SEQRES records: (download)

>d3op2a1 d.54.1.0 (A:4-132) automated matches {Bordetella bronchiseptica [TaxId: 518]}
kitevkahalstpipermrvesgaglklnrqmilvevrtdegvtgvgspsgpydlavlkr
aiedvigpqligedpaninylwhkvfhgevsrnlghrsvgiaamsgvdialwdlkgramn
qpiyqllgg

Sequence, based on observed residues (ATOM records): (download)

>d3op2a1 d.54.1.0 (A:4-132) automated matches {Bordetella bronchiseptica [TaxId: 518]}
kitevkahalstpipermrvesgaglklnrqmilvevrtdegvtgvgspsgpydlavlkr
aiedvigpqligedpaninylwhkvfhgevsrsvgiaamsgvdialwdlkgramnqpiyq
llgg

SCOPe Domain Coordinates for d3op2a1:

Click to download the PDB-style file with coordinates for d3op2a1.
(The format of our PDB-style files is described here.)

Timeline for d3op2a1: