SCOPe 2.05: Domain d3omzc2: 3omz C:139-250

Lineage for d3omzc2 (3omz C:139-250)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d3omzc2: 3omz C:139-250 [248316]
   automated match to d4mayc1

Details for d3omzc2

PDB Entry: 3omz, 3.04 Å

PDB Description: Crystal structure of MICA-specific human gamma delta T cell receptor

PDB Compounds: (C:) human Vdelta1 gamma delta T cell receptor delta1A/B-3

SCOPe Domain Sequences for d3omzc2:

Sequence, based on SEQRES records:

>d3omzc2 b.1.1.0 (C:139-250) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vtqaqssvsmpvrkavtlnclyetswwsyyifwykrlpskemiflirqgsdeqnaksgry
svnfkkaaksvaltisalqledsakyfcalgesltradklifgkgtrvtvep

Sequence, based on observed residues (ATOM records):

>d3omzc2 b.1.1.0 (C:139-250) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vtqssvsmpvrkavtlnclyetswwsyyifwykrlpskemiflirqgsdeqnaksgrysv
nfkkaaksvaltisalqledsakyfcalgesltradklifgkgtrvtvep

Timeline for d3omzc2:

• d3omzc2 first appeared in SCOPe 2.04
  
• d3omzc2 appears in SCOPe 2.06
  
• d3omzc2 appears in the current release, SCOPe 2.08