| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (19 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries) |
| Domain d3omzc1: 3omz C:11-116 [248315] automated match to d4mayc1 |
PDB Entry: 3omz (more details), 3.04 Å
SCOPe Domain Sequences for d3omzc1:
Sequence, based on SEQRES records: (download)
>d3omzc1 b.1.1.0 (C:11-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svirqtgssaeitcdlaegstgyihwylhqegkapqrllyydsytssvvlesgispgkyd
tygstrknlrmilrnliendsgvyycatwdqnyykklfgsgtslvv
>d3omzc1 b.1.1.0 (C:11-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svirqtgssaeitcdlgyihwylhqegkapqrllyydsytssvvlesgispgkydtnlrm
ilrnliendsgvyycatwdqnyykklfgsgtslvv
Timeline for d3omzc1: