SCOPe 2.07: Domain d3ojxa1: 3ojx A:67-239

Lineage for d3ojxa1 (3ojx A:67-239)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.0: automated matches [191330] (1 protein)
   not a true family

6. Protein automated matches [190158] (30 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [255999] (16 PDB entries)

8. Domain d3ojxa1: 3ojx A:67-239 [248310]
   Other proteins in same PDB: d3ojxa2, d3ojxa3
   automated match to d1ja1a2
   complexed with fad, fmn, nap

Details for d3ojxa1

PDB Entry: 3ojx, 2.5 Å

PDB Description: disulfide crosslinked cytochrome p450 reductase inactive

PDB Compounds: (A:) nadph-cytochrome p450 reductase

SCOPe Domain Sequences for d3ojxa1:

Sequence; same for both SEQRES and ATOM records:

>d3ojxa1 c.23.5.0 (A:67-239) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ssfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpeeydladlsslp
eidkslvvfamatygegdptcnaqdfydwlqetdvdltgvkfavfglgnktyehfnamgk
yvdqrleqlgaqrifelglgdddgnleedfitwreqfwpavaeffgveatgee

Timeline for d3ojxa1:

• d3ojxa1 first appeared in SCOPe 2.04
  
• d3ojxa1 appears in SCOPe 2.06
  
• d3ojxa1 appears in the current release, SCOPe 2.08