SCOPe 2.08: Domain d3ojbd1: 3ojb D:10-139

Lineage for d3ojbd1 (3ojb D:10-139)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (70 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187655] (109 PDB entries)

8. Domain d3ojbd1: 3ojb D:10-139 [248305]
   Other proteins in same PDB: d3ojba2, d3ojbb2, d3ojbc2, d3ojbd2
   automated match to d3nv1a_

Details for d3ojbd1

PDB Entry: 3ojb, 3.01 Å

PDB Description: Crystal structure of C-terminal domain of human galectin-8

PDB Compounds: (D:) Galectin-8

SCOPe Domain Sequences for d3ojbd1:

Sequence; same for both SEQRES and ATOM records:

>d3ojbd1 b.29.1.0 (D:10-139) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pfaarlntpmgpgrtvvvkgevnanaksfnvdllagkskdialhlnprlnikafvrnsfl
qeswgeeernitsfpfspgmyfemiiycdvrefkvavngvhsleykhrfkelssidtlei
ngdihllevr

Timeline for d3ojbd1:

• d3ojbd1 first appeared in SCOPe 2.04, called d3ojbd_
  
• d3ojbd1 appears in SCOPe 2.07