| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
| Protein automated matches [190437] (70 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187655] (109 PDB entries) |
| Domain d3ojbd1: 3ojb D:10-139 [248305] Other proteins in same PDB: d3ojba2, d3ojbb2, d3ojbc2, d3ojbd2 automated match to d3nv1a_ |
PDB Entry: 3ojb (more details), 3.01 Å
SCOPe Domain Sequences for d3ojbd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ojbd1 b.29.1.0 (D:10-139) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pfaarlntpmgpgrtvvvkgevnanaksfnvdllagkskdialhlnprlnikafvrnsfl
qeswgeeernitsfpfspgmyfemiiycdvrefkvavngvhsleykhrfkelssidtlei
ngdihllevr
Timeline for d3ojbd1: