Lineage for d3ojbb1 (3ojb B:10-139)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2375103Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2375104Protein automated matches [190437] (55 species)
    not a true protein
  7. 2375328Species Human (Homo sapiens) [TaxId:9606] [187655] (81 PDB entries)
  8. 2375477Domain d3ojbb1: 3ojb B:10-139 [248303]
    Other proteins in same PDB: d3ojba2, d3ojbb2, d3ojbc2, d3ojbd2
    automated match to d3nv1a_

Details for d3ojbb1

PDB Entry: 3ojb (more details), 3.01 Å

PDB Description: Crystal structure of C-terminal domain of human galectin-8
PDB Compounds: (B:) Galectin-8

SCOPe Domain Sequences for d3ojbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ojbb1 b.29.1.0 (B:10-139) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pfaarlntpmgpgrtvvvkgevnanaksfnvdllagkskdialhlnprlnikafvrnsfl
qeswgeeernitsfpfspgmyfemiiycdvrefkvavngvhsleykhrfkelssidtlei
ngdihllevr

SCOPe Domain Coordinates for d3ojbb1:

Click to download the PDB-style file with coordinates for d3ojbb1.
(The format of our PDB-style files is described here.)

Timeline for d3ojbb1: