Lineage for d3oj5u_ (3oj5 U:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1727563Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1727564Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1729675Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1729676Protein automated matches [190036] (33 species)
    not a true protein
  7. 1729872Species Mycobacterium tuberculosis [TaxId:419947] [255998] (2 PDB entries)
  8. 1729893Domain d3oj5u_: 3oj5 U: [248298]
    automated match to d1z4aa_

Details for d3oj5u_

PDB Entry: 3oj5 (more details), 2.85 Å

PDB Description: Mycobacterium tuberculosis ferritin homolog, BfrB
PDB Compounds: (U:) Ferritin family protein

SCOPe Domain Sequences for d3oj5u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oj5u_ a.25.1.0 (U:) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
ktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhll
drdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqw
flqeqieevalmatlvrvadraganlfelenfvarev

SCOPe Domain Coordinates for d3oj5u_:

Click to download the PDB-style file with coordinates for d3oj5u_.
(The format of our PDB-style files is described here.)

Timeline for d3oj5u_: