Lineage for d3oj5d_ (3oj5 D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2317148Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2317149Protein automated matches [190036] (58 species)
    not a true protein
  7. 2317656Species Mycobacterium tuberculosis [TaxId:419947] [255998] (2 PDB entries)
  8. 2317660Domain d3oj5d_: 3oj5 D: [248281]
    automated match to d1z4aa_

Details for d3oj5d_

PDB Entry: 3oj5 (more details), 2.85 Å

PDB Description: Mycobacterium tuberculosis ferritin homolog, BfrB
PDB Compounds: (D:) Ferritin family protein

SCOPe Domain Sequences for d3oj5d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oj5d_ a.25.1.0 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
ktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhll
drdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqw
flqeqieevalmatlvrvadraganlfelenfvarev

SCOPe Domain Coordinates for d3oj5d_:

Click to download the PDB-style file with coordinates for d3oj5d_.
(The format of our PDB-style files is described here.)

Timeline for d3oj5d_: