![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
![]() | Protein automated matches [190036] (29 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:419947] [255998] (1 PDB entry) |
![]() | Domain d3oj5d_: 3oj5 D: [248281] automated match to d1z4aa_ |
PDB Entry: 3oj5 (more details), 2.85 Å
SCOPe Domain Sequences for d3oj5d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oj5d_ a.25.1.0 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 419947]} ktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhll drdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqw flqeqieevalmatlvrvadraganlfelenfvarev
Timeline for d3oj5d_: