SCOPe 2.05: Domain d3oixd_: 3oix D:

Lineage for d3oixd_ (3oix D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families)

5. Family c.1.4.0: automated matches [191310] (1 protein)
   not a true family

6. Protein automated matches [190048] (17 species)
   not a true protein

7. Species Streptococcus mutans [TaxId:1309] [255997] (2 PDB entries)

8. Domain d3oixd_: 3oix D: [248277]
   automated match to d2b4gb_
   complexed with fmn, gol

Details for d3oixd_

PDB Entry: 3oix, 2.4 Å

PDB Description: crystal structure of the putative dihydroorotate dehydrogenase from streptococcus mutans

PDB Compounds: (D:) Putative dihydroorotate dehydrogenase; dihydroorotate oxidase

SCOPe Domain Sequences for d3oixd_:

Sequence; same for both SEQRES and ATOM records:

>d3oixd_ c.1.4.0 (D:) automated matches {Streptococcus mutans [TaxId: 1309]}
vsthttigsfdfdnclmnaagvycmtreelaaidhseagsfvtktgtleeragnpqprya
dtklgsinsmglpnlginyyldyvtelqkqpdsknhflslvgmspeethtilkmveasky
qglvelnlscpnvpgkpqiaydfettdqilsevftyftkplgiklppyfdivhfdqaaai
fnkypltfvncinsignglviedetvvikpkngfggiggdyvkptalanvhafykrlnps
iqiigtggvktgrdafehilcgasmvqigtalhqegpqifkritkelkaimtekgyetle
dfrgklnam

Timeline for d3oixd_:

• d3oixd_ first appeared in SCOPe 2.04
  
• d3oixd_ appears in SCOPe 2.06
  
• d3oixd_ appears in the current release, SCOPe 2.08