Lineage for d3ohba1 (3ohb A:1-389)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2246832Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2246833Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2248370Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (5 proteins)
    contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)
  6. 2248475Protein automated matches [231300] (4 species)
    not a true protein
  7. 2248476Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [231489] (6 PDB entries)
  8. 2248477Domain d3ohba1: 3ohb A:1-389 [248272]
    Other proteins in same PDB: d3ohba2, d3ohba3
    automated match to d3mfha1
    protein/DNA complex; complexed with dcp, mg, so4

Details for d3ohba1

PDB Entry: 3ohb (more details), 2 Å

PDB Description: yeast dna polymerase eta extending from an 8-oxog lesion
PDB Compounds: (A:) DNA Polymerase ETA

SCOPe Domain Sequences for d3ohba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ohba1 e.8.1.7 (A:1-389) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mskftwkeliqlgspskayesslaciahidmnaffaqveqmrcglskedpvvcvqwnsii
avsyaarkygisrmdtiqealkkcsnlipihtavfkkgedfwqyhdgcgswvqdpakqis
vedhkvslepyrresrkalaifkwacdlverasidevfldlgricfnmlmfdneyeltgd
lklkdalsnireafiggnydinshlplipekikslkfegdvfnpegrdlitdwddvilal
gsqvckgirdsikdilgyttscglsstknvcklasnykkpdaqtivkndclldfldcgkf
eitsfwtlggvlgkelidvldlphensikhiretwpdnagqlkefldakvkqsdydrsts
nidplktadlaeklfklsrgryglplssr

SCOPe Domain Coordinates for d3ohba1:

Click to download the PDB-style file with coordinates for d3ohba1.
(The format of our PDB-style files is described here.)

Timeline for d3ohba1: