Lineage for d1ey8a_ (1ey8 A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558996Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 558997Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) (S)
  5. 558998Family b.40.1.1: Staphylococcal nuclease [50200] (1 protein)
    barrel, closed; n=5, S=10
  6. 558999Protein Staphylococcal nuclease [50201] (1 species)
  7. 559000Species Staphylococcus aureus [TaxId:1280] [50202] (67 PDB entries)
  8. 559019Domain d1ey8a_: 1ey8 A: [24827]
    mutant

Details for d1ey8a_

PDB Entry: 1ey8 (more details), 1.75 Å

PDB Description: structure of s. nuclease stabilizing triple mutant p117g/h124l/s128a

SCOP Domain Sequences for d1ey8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ey8a_ b.40.1.1 (A:) Staphylococcal nuclease {Staphylococcus aureus}
lhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkmv
enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllr
kaeaqakkeklniws

SCOP Domain Coordinates for d1ey8a_:

Click to download the PDB-style file with coordinates for d1ey8a_.
(The format of our PDB-style files is described here.)

Timeline for d1ey8a_: