Lineage for d1ey8a_ (1ey8 A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58940Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 58941Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) (S)
  5. 58942Family b.40.1.1: Staphylococcal nuclease [50200] (1 protein)
  6. 58943Protein Staphylococcal nuclease [50201] (1 species)
  7. 58944Species Staphylococcus aureus [TaxId:1280] [50202] (56 PDB entries)
  8. 58958Domain d1ey8a_: 1ey8 A: [24827]

Details for d1ey8a_

PDB Entry: 1ey8 (more details), 1.75 Å

PDB Description: structure of s. nuclease stabilizing triple mutant p117g/h124l/s128a

SCOP Domain Sequences for d1ey8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ey8a_ b.40.1.1 (A:) Staphylococcal nuclease {Staphylococcus aureus}
lhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkmv
enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllr
kaeaqakkeklniws

SCOP Domain Coordinates for d1ey8a_:

Click to download the PDB-style file with coordinates for d1ey8a_.
(The format of our PDB-style files is described here.)

Timeline for d1ey8a_: