SCOPe 2.08: Domain d3ogva5: 3ogv A:853-1023

Lineage for d3ogva5 (3ogv A:853-1023)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.0: automated matches [191481] (1 protein)
   not a true family

6. Protein automated matches [190770] (51 species)
   not a true protein

7. Species Trichoderma reesei [TaxId:51453] [255996] (4 PDB entries)

8. Domain d3ogva5: 3ogv A:853-1023 [248269]
   Other proteins in same PDB: d3ogva1, d3ogva2, d3ogva3
   automated match to d1tg7a3
   complexed with nag, ptq

Details for d3ogva5

PDB Entry: 3ogv, 1.4 Å

PDB Description: complex structure of beta-galactosidase from trichoderma reesei with petg

PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d3ogva5:

Sequence; same for both SEQRES and ATOM records:

>d3ogva5 b.18.1.0 (A:853-1023) automated matches {Trichoderma reesei [TaxId: 51453]}
rdvfrgplnegglfferqgfhlpspplsdfthgpsssssssspldgiahagiafyaaklp
lhlpaqeydiplsfvfdnataaapyrallyvngfqygkyvsnigpqtefpvpegildyng
dnwigvalwalesrgakvpglalkskspiltgrervevvkgphfkkrhgay

Timeline for d3ogva5:

• d3ogva5 first appeared in SCOPe 2.04
  
• d3ogva5 appears in SCOPe 2.07