Class b: All beta proteins [48724] (176 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
Protein automated matches [226835] (27 species) not a true protein |
Species Trichoderma reesei [TaxId:51453] [255994] (4 PDB entries) |
Domain d3ogva2: 3ogv A:394-571 [248266] Other proteins in same PDB: d3ogva1, d3ogva3, d3ogva4, d3ogva5 automated match to d1tg7a4 complexed with nag, ptq |
PDB Entry: 3ogv (more details), 1.4 Å
SCOPe Domain Sequences for d3ogva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ogva2 b.71.1.0 (A:394-571) automated matches {Trichoderma reesei [TaxId: 51453]} gyitatpenatqgvysdsqnivitpllakesgdffvvrhanysstdtasytvklptsagd ltipqlggsltltgrdskihvtdypvgkftllystaeiftwnefaektvlvlyggaqelh efavknpfgssktakakkiegsnvtihttsnltvvlqwtassarqvvqlgslviymvd
Timeline for d3ogva2:
View in 3D Domains from same chain: (mouse over for more information) d3ogva1, d3ogva3, d3ogva4, d3ogva5 |