SCOPe 2.04: Domain d3ogsa3: 3ogs A:572-668

Lineage for d3ogsa3 (3ogs A:572-668)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.149: Beta-galactosidase LacA, domain 3 [117099] (1 superfamily)
   sandwich; 8 strands in 2 sheets

4. Superfamily b.149.1: Beta-galactosidase LacA, domain 3 [117100] (2 families)
   automatically mapped to Pfam PF13363

5. Family b.149.1.0: automated matches [254310] (1 protein)
   not a true family

6. Protein automated matches [254712] (2 species)
   not a true protein

7. Species Trichoderma reesei [TaxId:51453] [255995] (4 PDB entries)

8. Domain d3ogsa3: 3ogs A:572-668 [248262]
   Other proteins in same PDB: d3ogsa1, d3ogsa2, d3ogsa4, d3ogsa5
   automated match to d1tg7a1
   complexed with ipt, nag

Details for d3ogsa3

PDB Entry: 3ogs, 1.75 Å

PDB Description: complex structure of beta-galactosidase from trichoderma reesei with iptg

PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d3ogsa3:

Sequence; same for both SEQRES and ATOM records:

>d3ogsa3 b.149.1.0 (A:572-668) automated matches {Trichoderma reesei [TaxId: 51453]}
rnsaynywvptlpgsgkqsaygsslmnpdsviinggylirsvaikgnalsvqadfnvttp
leiigipkgisklavngkelgysvselgdwiahpaie

Timeline for d3ogsa3:

• d3ogsa3 is new in SCOPe 2.04-stable
  
• d3ogsa3 appears in SCOPe 2.05
  
• d3ogsa3 appears in the current release, SCOPe 2.08