Lineage for d3ogsa1 (3ogs A:38-393)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (90 species)
    not a true protein
  7. 2084289Species Trichoderma reesei [TaxId:51453] [225935] (5 PDB entries)
  8. 2084297Domain d3ogsa1: 3ogs A:38-393 [248260]
    Other proteins in same PDB: d3ogsa2, d3ogsa3, d3ogsa4, d3ogsa5
    automated match to d1tg7a5
    complexed with ipt, nag

Details for d3ogsa1

PDB Entry: 3ogs (more details), 1.75 Å

PDB Description: Complex structure of beta-galactosidase from Trichoderma reesei with IPTG
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d3ogsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ogsa1 c.1.8.0 (A:38-393) automated matches {Trichoderma reesei [TaxId: 51453]}
akgplqnivtwdehslfvhgervvifsgevhpfrlpvpslyldvfhkikalgfntvsfyv
dwallegkpgrfradgifslepffeaatkagiyllarpgpyinaevsgggfpgwlqrvkg
klrtdapdylhatdnyvahiasiiakaqitnggpvilyqpeneysgaaegvlfpnkpymq
yvidqarnagiivplinndafpggtgapgtglgsvdiyghdgyplgfdcahpsawpdngl
pttwrqdhlnispstpfslvefqggafdpfggwgfeqcsalvnhefervfyknnmaagvt
ifniymtfggtnwgnlghpggytsydygasiredrridrekyselklqgqflkvsp

SCOPe Domain Coordinates for d3ogsa1:

Click to download the PDB-style file with coordinates for d3ogsa1.
(The format of our PDB-style files is described here.)

Timeline for d3ogsa1: