![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
![]() | Protein automated matches [190770] (51 species) not a true protein |
![]() | Species Trichoderma reesei [TaxId:51453] [255996] (4 PDB entries) |
![]() | Domain d3ogra4: 3ogr A:669-852 [248258] Other proteins in same PDB: d3ogra1, d3ogra2, d3ogra3 automated match to d1tg7a2 complexed with gal, nag |
PDB Entry: 3ogr (more details), 1.5 Å
SCOPe Domain Sequences for d3ogra4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ogra4 b.18.1.0 (A:669-852) automated matches {Trichoderma reesei [TaxId: 51453]} iphvqvpeltklkwykvdslpeirsnyddsrwplanlrtsnntyaplktpvslygsdygf hagtllfrgrftartarqqlflstqggsafassvwlndrfigsftgfdaasaanssytld rlvrgrryiltvvvdstgldenwttgddsmkaprgildyaltsssganvsiswkltgnlg gedy
Timeline for d3ogra4:
![]() Domains from same chain: (mouse over for more information) d3ogra1, d3ogra2, d3ogra3, d3ogra5 |