SCOPe 2.08: Domain d3ogra4: 3ogr A:669-852

Lineage for d3ogra4 (3ogr A:669-852)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.0: automated matches [191481] (1 protein)
   not a true family

6. Protein automated matches [190770] (51 species)
   not a true protein

7. Species Trichoderma reesei [TaxId:51453] [255996] (4 PDB entries)

8. Domain d3ogra4: 3ogr A:669-852 [248258]
   Other proteins in same PDB: d3ogra1, d3ogra2, d3ogra3
   automated match to d1tg7a2
   complexed with gal, nag

Details for d3ogra4

PDB Entry: 3ogr, 1.5 Å

PDB Description: complex structure of beta-galactosidase from trichoderma reesei with galactose

PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d3ogra4:

Sequence; same for both SEQRES and ATOM records:

>d3ogra4 b.18.1.0 (A:669-852) automated matches {Trichoderma reesei [TaxId: 51453]}
iphvqvpeltklkwykvdslpeirsnyddsrwplanlrtsnntyaplktpvslygsdygf
hagtllfrgrftartarqqlflstqggsafassvwlndrfigsftgfdaasaanssytld
rlvrgrryiltvvvdstgldenwttgddsmkaprgildyaltsssganvsiswkltgnlg
gedy

Timeline for d3ogra4:

• d3ogra4 first appeared in SCOPe 2.04
  
• d3ogra4 appears in SCOPe 2.07