Lineage for d3ogra2 (3ogr A:394-571)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2066963Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2066964Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2067553Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 2067554Protein automated matches [226835] (34 species)
    not a true protein
  7. 2067755Species Trichoderma reesei [TaxId:51453] [255994] (4 PDB entries)
  8. 2067758Domain d3ogra2: 3ogr A:394-571 [248256]
    Other proteins in same PDB: d3ogra1, d3ogra3, d3ogra4, d3ogra5
    automated match to d1tg7a4
    complexed with gal, nag

Details for d3ogra2

PDB Entry: 3ogr (more details), 1.5 Å

PDB Description: Complex structure of beta-galactosidase from Trichoderma reesei with galactose
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d3ogra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ogra2 b.71.1.0 (A:394-571) automated matches {Trichoderma reesei [TaxId: 51453]}
gyitatpenatqgvysdsqnivitpllakesgdffvvrhanysstdtasytvklptsagd
ltipqlggsltltgrdskihvtdypvgkftllystaeiftwnefaektvlvlyggaqelh
efavknpfgssktakakkiegsnvtihttsnltvvlqwtassarqvvqlgslviymvd

SCOPe Domain Coordinates for d3ogra2:

Click to download the PDB-style file with coordinates for d3ogra2.
(The format of our PDB-style files is described here.)

Timeline for d3ogra2: