Lineage for d3ogra1 (3ogr A:38-393)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (90 species)
    not a true protein
  7. 2084289Species Trichoderma reesei [TaxId:51453] [225935] (5 PDB entries)
  8. 2084292Domain d3ogra1: 3ogr A:38-393 [248255]
    Other proteins in same PDB: d3ogra2, d3ogra3, d3ogra4, d3ogra5
    automated match to d1tg7a5
    complexed with gal, nag

Details for d3ogra1

PDB Entry: 3ogr (more details), 1.5 Å

PDB Description: Complex structure of beta-galactosidase from Trichoderma reesei with galactose
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d3ogra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ogra1 c.1.8.0 (A:38-393) automated matches {Trichoderma reesei [TaxId: 51453]}
akgplqnivtwdehslfvhgervvifsgevhpfrlpvpslyldvfhkikalgfntvsfyv
dwallegkpgrfradgifslepffeaatkagiyllarpgpyinaevsgggfpgwlqrvkg
klrtdapdylhatdnyvahiasiiakaqitnggpvilyqpeneysgaaegvlfpnkpymq
yvidqarnagiivplinndafpggtgapgtglgsvdiyghdgyplgfdcahpsawpdngl
pttwrqdhlnispstpfslvefqggafdpfggwgfeqcsalvnhefervfyknnmaagvt
ifniymtfggtnwgnlghpggytsydygasiredrridrekyselklqgqflkvsp

SCOPe Domain Coordinates for d3ogra1:

Click to download the PDB-style file with coordinates for d3ogra1.
(The format of our PDB-style files is described here.)

Timeline for d3ogra1: