SCOPe 2.04: Domain d3og8b_: 3og8 B:

Lineage for d3og8b_ (3og8 B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.88: Mss4-like [51315] (2 superfamilies)
   complex fold made of several coiled beta-sheets

4. Superfamily b.88.2: RIG-I C-terminal-like [254142] (2 families)
   Pfam PF11648

5. Family b.88.2.1: RIG-I C-terminal domain-like [254188] (4 proteins)

6. Protein RIG-I C-terminal domain [254412] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [254851] (5 PDB entries)

8. Domain d3og8b_: 3og8 B: [248252]
   automated match to d2qfba_
   protein/RNA complex; complexed with zn

Details for d3og8b_

PDB Entry: 3og8, 2.4 Å

PDB Description: Crystal structure of human RIG-I CTD bound to a 14-bp blunt-ended dsRNA

PDB Compounds: (B:) ATP-dependent RNA helicase DDX58

SCOPe Domain Sequences for d3og8b_:

Sequence; same for both SEQRES and ATOM records:

>d3og8b_ b.88.2.1 (B:) RIG-I C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mdkenkkllcrkckalacytadvrvieeshytvlgdafkecfvsrphpkpkqfssfekra
kifcarqncshdwgihvkyktfeipvikiesfvvediatgvqtlyskwkdfhfekipfdp
aemskleh

Timeline for d3og8b_:

• d3og8b_ is new in SCOPe 2.04-stable
  
• d3og8b_ appears in SCOPe 2.05
  
• d3og8b_ appears in the current release, SCOPe 2.08, called d3og8b1