| Class b: All beta proteins [48724] (180 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
| Protein automated matches [190770] (51 species) not a true protein |
| Species Trichoderma reesei [TaxId:51453] [255996] (4 PDB entries) |
| Domain d3og2a5: 3og2 A:853-1023 [248250] Other proteins in same PDB: d3og2a1, d3og2a2, d3og2a3 automated match to d1tg7a3 complexed with gol, nag |
PDB Entry: 3og2 (more details), 1.2 Å
SCOPe Domain Sequences for d3og2a5:
Sequence; same for both SEQRES and ATOM records: (download)
>d3og2a5 b.18.1.0 (A:853-1023) automated matches {Trichoderma reesei [TaxId: 51453]}
rdvfrgplnegglfferqgfhlpspplsdfthgpsssssssspldgiahagiafyaaklp
lhlpaqeydiplsfvfdnataaapyrallyvngfqygkyvsnigpqtefpvpegildyng
dnwigvalwalesrgakvpglalkskspiltgrervevvkgphfkkrhgay
Timeline for d3og2a5:
View in 3DDomains from same chain: (mouse over for more information) d3og2a1, d3og2a2, d3og2a3, d3og2a4 |