SCOPe 2.07: Domain d3oehx3: 3oeh X:358-475

Lineage for d3oehx3 (3oeh X:358-475)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families)

5. Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)

6. Protein F1 ATP synthase beta subunit, domain 3 [88928] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310898] (6 PDB entries)

8. Domain d3oehx3: 3oeh X:358-475 [248245]
   Other proteins in same PDB: d3oehd1, d3oehd2, d3oehe1, d3oehe2, d3oehf1, d3oehf2, d3oehg_, d3oehh1, d3oehh2, d3oehi_, d3oehm1, d3oehm2, d3oehn1, d3oehn2, d3oeho1, d3oeho2, d3oehp_, d3oehr_, d3oehv1, d3oehv2, d3oehw1, d3oehw2, d3oehx1, d3oehx2
   automated match to d2jdid1
   complexed with anp, mg; mutant

Details for d3oehx3

PDB Entry: 3oeh, 3 Å

PDB Description: Structure of four mutant forms of yeast F1 ATPase: beta-V279F

PDB Compounds: (X:) ATP synthase subunit beta

SCOPe Domain Sequences for d3oehx3:

Sequence; same for both SEQRES and ATOM records:

>d3oehx3 a.69.1.1 (X:358-475) F1 ATP synthase beta subunit, domain 3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqp
favaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa

Timeline for d3oehx3:

• d3oehx3 first appeared in SCOPe 2.04
  
• d3oehx3 appears in SCOPe 2.06
  
• d3oehx3 appears in the current release, SCOPe 2.08