![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
![]() | Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (2 families) ![]() |
![]() | Family a.69.1.0: automated matches [254233] (1 protein) not a true family |
![]() | Protein automated matches [254528] (6 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255214] (6 PDB entries) |
![]() | Domain d3oehx3: 3oeh X:358-475 [248245] Other proteins in same PDB: d3oehd1, d3oehd2, d3oehe1, d3oehe2, d3oehf1, d3oehf2, d3oehg_, d3oehm1, d3oehm2, d3oehn1, d3oehn2, d3oeho1, d3oeho2, d3oehp_, d3oehv1, d3oehv2, d3oehw1, d3oehw2, d3oehx1, d3oehx2 automated match to d2jdid1 complexed with anp, mg; mutant |
PDB Entry: 3oeh (more details), 3 Å
SCOPe Domain Sequences for d3oehx3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oehx3 a.69.1.0 (X:358-475) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqp favaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa
Timeline for d3oehx3:
![]() Domains from other chains: (mouse over for more information) d3oehd1, d3oehd2, d3oehd3, d3oehe1, d3oehe2, d3oehe3, d3oehf1, d3oehf2, d3oehf3, d3oehg_, d3oehm1, d3oehm2, d3oehm3, d3oehn1, d3oehn2, d3oehn3, d3oeho1, d3oeho2, d3oeho3, d3oehp_, d3oehv1, d3oehv2, d3oehv3, d3oehw1, d3oehw2, d3oehw3 |